RecombinantBetacellulin,Human

Catalog Number: BWT-BK0298
Article Name: RecombinantBetacellulin,Human
Biozol Catalog Number: BWT-BK0298
Supplier Catalog Number: BK0298
Alternative Catalog Number: BWT-BK0298-10UG,BWT-BK0298-50UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Betacellulin (BTC) is a member of the EGF family of cytokines that also includes EGF, TGF-alpha, Amphiregulin, HB-EGF, Epiregulin, Tomoregulin, Heregulin and Neuregulins. At the amino acid sequence level, human mature BTC protein exhibits 80% identity with m
Molecular Weight: 15~18 kDa, observed by reducing SDS-PAGE.
Source: HEK 293
Purity: > 95% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.