RecombinantBetacellulin,Mouse(HEK293-expressed)

Catalog Number: BWT-BK0299
Article Name: RecombinantBetacellulin,Mouse(HEK293-expressed)
Biozol Catalog Number: BWT-BK0299
Supplier Catalog Number: BK0299
Alternative Catalog Number: BWT-BK0299-10UG,BWT-BK0299-1MG,BWT-BK0299-50UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Betacellulin, also known as BTC, belongs to the EGF family of growth factors. It is expressed in many tissues, such as kidney, pancreas and small intestine. Betacellulin is initially synthesized as a membrane-bound precursor containing multiple EGF-like
Molecular Weight: 19-24 kDa, observed by reducing SDS-PAGE.
Source: HEK 293
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.