RecombinantCT-1,Mouse

Product Overview

• Article Name: RecombinantCT-1,Mouse
• Biozol Catalog Number: BWT-BK0301
• Supplier Catalog Number: BK0301
• Alternative Catalog Number: BWT-BK0301-10UG,BWT-BK0301-1MG,BWT-BK0301-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Cardiotrophin-1 (CT-1) is a member of the cytokine family which also includes IL-6, IL-11, leukemia inhibitory factor (LIF), oncostatin M (OSM), and ciliary neurotrophic factor (CNTF). CT-1 is associated with the pathophysiology of several types of heart

Product Properties

• Molecular Weight: 22~27 kDa, observed by reducing SDS-PAGE.
• Source: HEK 293
• Purity: > 95% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: SQREGSLEDHQTDSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGL PVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLF TANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQLVPGGVA
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.