RecombinantENA-78/CXCL5,Human(HEK293-expressed)

Product Overview

• Article Name: RecombinantENA-78/CXCL5,Human(HEK293-expressed)
• Biozol Catalog Number: BWT-BK0302
• Supplier Catalog Number: BK0302
• Alternative Catalog Number: BWT-BK0302-25UG,BWT-BK0302-5UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Epithelial-derived neutrophil-activating peptide 78 (ENA-78) is a small cytokine belonging to the CXC chemokine family. It is produced following stimulation of cells with the inflammatory cytokines interleukin-1 or tumor necrosis factor-alpha. Expression

Product Properties

• Molecular Weight: 8.5 kDa, observed by reducing SDS-PAGE.
• Source: HEK 293
• Purity: > 98% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEA PFLKKVIQKILDGGNKEN
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.