RecombinantFasR,Human

Catalog Number: BWT-BK0303
Article Name: RecombinantFasR,Human
Biozol Catalog Number: BWT-BK0303
Supplier Catalog Number: BK0303
Alternative Catalog Number: BWT-BK0303-10UG,BWT-BK0303-1MG,BWT-BK0303-50UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Fas Receptor and Fas Ligand (FasL) belong to the TNF superfamily and are type I and type II transmembrane proteins, respectively. Binding of FasL to Fas triggers apoptosis in Fas-bearing cells. The mechanism of apoptosis involves recruitment of pro-caspa
Molecular Weight: 17~29 kDa, observed by reducing SDS-PAGE.
Source: HEK 293
Purity: > 95% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCR LCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRS
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.