RecombinantG-CSF,Rat(HEK293-expressed)

Catalog Number: BWT-BK0305
Article Name: RecombinantG-CSF,Rat(HEK293-expressed)
Biozol Catalog Number: BWT-BK0305
Supplier Catalog Number: BK0305
Alternative Catalog Number: BWT-BK0305-10UG,BWT-BK0305-1MG,BWT-BK0305-50UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Among the family of colony-stimulating factors, Granulocyte Colony-Stimulating Factor (G-CSF) is the most potent inducer of terminal differentiation of leukemic myeloid cell lines into granulocytes and macrophages. G-CSF synthesis can be induced by bacte
Molecular Weight: 25~28 kDa, observed by reducing SDS-PAGE.
Source: HEK 293
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: IPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKC LSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVT SYLQSFLETAHHALHHLPRPAQKHFPESLFISI
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.