RecombinantIFN-beta,Human

Catalog Number: BWT-BK0307
Article Name: RecombinantIFN-beta,Human
Biozol Catalog Number: BWT-BK0307
Supplier Catalog Number: BK0307
Alternative Catalog Number: BWT-BK0307-25UG,BWT-BK0307-5UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Interferon-beta (IFN-beta), acting via STAT1 and STAT2, is known to upregulate and downregulate a wide variety of genes, most of which are involved in the antiviral immune response. It is a member of Type I IFNs, which include IFN-alpha, -beta, tau, and -omega. IFN-beta pl
Molecular Weight: ~23 kDa, observed by reducing SDS-PAGE.
Source: HEK 293
Purity: > 95% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWN ETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRL TGYLRN
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.