RecombinantIL-1RA,Human(HEK293-expressed)

Product Overview

• Article Name: RecombinantIL-1RA,Human(HEK293-expressed)
• Biozol Catalog Number: BWT-BK0310
• Supplier Catalog Number: BK0310
• Alternative Catalog Number: BWT-BK0310-10UG,BWT-BK0310-1MG,BWT-BK0310-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

IL-1 Receptor Antagonist, also known as IL-1RA, ICIL-1RA, IRAP and IL-1RN, is a member of the interleukin 1 cytokine family. It is expressed by monocytes, neutrophils, macrophages, epithelial cells and fibroblasts. IL-1RA inhibits the activity of both IL

Product Properties

• Molecular Weight: 18-23 kDa, observed by reducing SDS-PAGE.
• Source: HEK 293
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQL EAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.