RecombinantIL-11,Mouse(HEK293-expressed) Preis auf Anfrage

Catalog Number: BWT-BK0311
Article Name: RecombinantIL-11,Mouse(HEK293-expressed) Preis auf Anfrage
Biozol Catalog Number: BWT-BK0311
Supplier Catalog Number: BK0311
Alternative Catalog Number: BWT-BK0311-10UG,BWT-BK0311-50UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Interleukin-11 (IL-11) is a pleiotropic cytokine that was originally detected in the conditioned medium of an IL-1alpha-stimulated primate bone marrow stromal cell line (PU-34) as a mitogen for the IL-6-responsive mouse plasmacytoma cell line T11. IL-11 cont
Molecular Weight: ~21 kDa, observed by reducing SDS-PAGE.
Source: HEK 293
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: GPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLM SYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLH LTLDWAVRGLLLLKTRL
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.