RecombinantIL-22,Human(HEK293-expressed)

Catalog Number: BWT-BK0315
Article Name: RecombinantIL-22,Human(HEK293-expressed)
Biozol Catalog Number: BWT-BK0315
Supplier Catalog Number: BK0315
Alternative Catalog Number: BWT-BK0315-10UG,BWT-BK0315-1MG,BWT-BK0315-50UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Interleukin-22 (IL-22) is a member of the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biolo
Molecular Weight: 16~28 kDa, observed by reducing SDS-PAGE.
Source: HEK 293
Purity: > 95% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQP YMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.