RecombinantIL-4R,Human

Catalog Number: BWT-BK0316
Article Name: RecombinantIL-4R,Human
Biozol Catalog Number: BWT-BK0316
Supplier Catalog Number: BK0316
Alternative Catalog Number: BWT-BK0316-10UG,BWT-BK0316-1MG,BWT-BK0316-50UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Interleukin-4 Receptor, also known as IL-4RA and CD124, is a transmembrane glycoprotein belonging to the class I receptor family. It is highly expressed by activated T-cells. IL-4RA couples with gamma chain to form the type I receptor for IL-4. The extracell
Molecular Weight: 40-45 kDa, observed by reducing SDS-PAGE.
Source: HEK 293
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDL WAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPS LRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.