RecombinantIL-6,Rat(HEK293-expressed)

Product Overview

• Article Name: RecombinantIL-6,Rat(HEK293-expressed)
• Biozol Catalog Number: BWT-BK0317
• Supplier Catalog Number: BK0317
• Alternative Catalog Number: BWT-BK0317-1MG,BWT-BK0317-25UG,BWT-BK0317-5UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Interleukin-6 (IL-6) is a pleiotropic cytokine that plays an important role in host defense by regulating immune and inflammatory responses. Produced by T cells, monocytes, fibroblasts, endothelial cells and keratinocytes, Interleukin-6 (IL-6) has divers

Product Properties

• Molecular Weight: 21~26 kDa , observed by reducing SDS-PAGE.
• Source: HEK 293
• Purity: > 95% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: FPTSQVRRGDFTEDTTHNRPVYTTSQVGGLITYVLREILEMRKELCNGNSDCMNSDDALSENNLKLPEIQRNDGCFQTGY NQEICLLKICSGLLEFRFYLEFVKNNLQDNKKDKARVIQSNTETLVHIFKQEIKDSYKIVLPTPTSNALLMEKLESQKEW LRTKTIQLILKALEEFLKVTMRSTRQT
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.