RecombinantIP-10/CRG-2/CXCL10,Rat

Product Overview

• Article Name: RecombinantIP-10/CRG-2/CXCL10,Rat
• Biozol Catalog Number: BWT-BK0318
• Supplier Catalog Number: BK0318
• Alternative Catalog Number: BWT-BK0318-1MG,BWT-BK0318-25UG,BWT-BK0318-5UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

C-X-C motif chemokine 10 (CXCL10) also known as interferon gamma-induced protein 10 (IP-10) or small-inducible cytokine B10, is originally identified as an IFN-gamma-inducible gene in monocytes, fibroblasts and endothelial cells. It has since been shown that

Product Properties

• Molecular Weight: 8.7 kDa, observed by reducing SDS-PAGE.
• Source: HEK 293
• Purity: > 98% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: IPLARTVRCTCIDFHEQPLRPRAIGKLEIIPASLSCPHVEIIATMKKNNEKRCLNPESEA IKSLLKAVSQRRSKRAP
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.