RecombinantI-TAC/CXCL11,Human(HEK293-expressed)

Product Overview

• Article Name: RecombinantI-TAC/CXCL11,Human(HEK293-expressed)
• Biozol Catalog Number: BWT-BK0319
• Supplier Catalog Number: BK0319
• Alternative Catalog Number: BWT-BK0319-10UG,BWT-BK0319-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Chemokine (C-X-C motif) ligand 11(CXCL11), also known as I-TAC and B-R1, is a small cytokine belonging to the CXC chemokine family that is also called Interferon-inducible T-cell alpha chemoattractant (I-TAC) and Interferon-gamma-inducible protein 9 (IP-

Product Properties

• Molecular Weight: 8.3 kDa, observed by reducing SDS-PAGE.
• Source: HEK 293
• Purity: > 98% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQ ARLIIKKVERKNF
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100µg/ml.