RecombinantMCP-1/CCL2,Mouse

Catalog Number: BWT-BK0320
Article Name: RecombinantMCP-1/CCL2,Mouse
Biozol Catalog Number: BWT-BK0320
Supplier Catalog Number: BK0320
Alternative Catalog Number: BWT-BK0320-1MG,BWT-BK0320-25UG,BWT-BK0320-5UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Chemokine (C-C motif) ligand 2 (CCL2) is also referred to as monocyte chemotactic protein 1 (MCP1) and small inducible cytokine A2. CCL2 is a small cytokine that belongs to the CC chemokine family. CCL2 recruits monocytes, memory T cells, and dendritic c
Molecular Weight: 8 kDa, observed by reducing SDS-PAGE.
Source: HEK 293
Purity: > 98% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.