RecombinantMIP-1alpha/CCL3,Mouse

Catalog Number: BWT-BK0322
Article Name: RecombinantMIP-1alpha/CCL3,Mouse
Biozol Catalog Number: BWT-BK0322
Supplier Catalog Number: BK0322
Alternative Catalog Number: BWT-BK0322-25UG,BWT-BK0322-5UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
MIP-1 alpha/CCL3, also known as LD78 alpha, is an inflammatory chemokine. MIP-1alpha belongs to the CCL chemokine family, and shares 68% homology with MIP-1beta. The mature form of MIP-1alpha contains 69 amino acids, exists as dimers in solution, and tends to under
Molecular Weight: 7.8 kDa, observed by reducing SDS-PAGE.
Source: HEK 293
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.