RecombinantOSM,Mouse(HEK293-expressed)

Product Overview

• Article Name: RecombinantOSM,Mouse(HEK293-expressed)
• Biozol Catalog Number: BWT-BK0326
• Supplier Catalog Number: BK0326
• Alternative Catalog Number: BWT-BK0326-10UG,BWT-BK0326-1MG,BWT-BK0326-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Oncostatin-M, also known as OSM, is a growth regulator belonging to the interleukin-6 group of cytokines. It is expressed mainly by monocytes, activated T cells and Kaposis sarcoma cells. OSM signals through two types of receptors, one is composed of gp

Product Properties

• Molecular Weight: 10-40 kDa, observed by reducing SDS-PAGE.
• Source: HEK 293
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: ANRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRV LYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGY HRFMGSVGRVFREWDDGSTRSRR
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.