RecombinantPDGF-CC,Human

Catalog Number: BWT-BK0327
Article Name: RecombinantPDGF-CC,Human
Biozol Catalog Number: BWT-BK0327
Supplier Catalog Number: BK0327
Alternative Catalog Number: BWT-BK0327-10UG,BWT-BK0327-50UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Platelet-Derived Growth Factor (PDGF) is a potent mitogen for a wide range of cell types including fibroblasts, smooth muscle, connective tissue, bone and cartilage cells, and some blood cells. The PDGF is involved in a number of biological processes, in
Molecular Weight: 15~19 kDa, observed by reducing SDS-PAGE.
Source: HEK 293
Purity: > 95% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPK TGVRGLHKSLTDVALEHHEECDCVCRGSTGG
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.