RecombinantPF-4/CXCL4,Human

Catalog Number: BWT-BK0328
Article Name: RecombinantPF-4/CXCL4,Human
Biozol Catalog Number: BWT-BK0328
Supplier Catalog Number: BK0328
Alternative Catalog Number: BWT-BK0328-10UG,BWT-BK0328-50UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Platelet factor 4, also known as CXCL4, is expressed in megakaryocytes and stored in the alpha-granules of platelets. Recombinant human PF-4 is a 7.8 kDa protein containing 70 amino acid residues, including the four highly conserved residues present in CXC c
Molecular Weight: ~7.8 kDa, observed by non-reducing SDS-PAGE.
Source: HEK 293
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.