RecombinantTRAILR-2,Human

Catalog Number: BWT-BK0333
Article Name: RecombinantTRAILR-2,Human
Biozol Catalog Number: BWT-BK0333
Supplier Catalog Number: BK0333
Alternative Catalog Number: BWT-BK0333-10UG,BWT-BK0333-1MG,BWT-BK0333-50UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
TRAIL Receptor-2 is a cell-surface receptor involved in tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-induced cell-death signaling. The death ligand TRAIL bears high potential as a new anticancer agent, as binding to the death receptors
Molecular Weight: ~15 kDa, observed by reducing SDS-PAGE.
Source: HEK 293
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTR NTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.