RecombinantVEGF165,Human(HEK293-expressed)

Product Overview

• Article Name: RecombinantVEGF165,Human(HEK293-expressed)
• Biozol Catalog Number: BWT-BK0335
• Supplier Catalog Number: BK0335
• Alternative Catalog Number: BWT-BK0335-10UG,BWT-BK0335-1MG,BWT-BK0335-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Vascular Endothelial Growth Factor is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, VEGF plays a prominent r

Product Properties

• Molecular Weight: 20~26 kDa, observed by reducing SDS-PAGE.
• Source: HEK 293
• Purity: > 95% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQI MRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRC DKPRR
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.