RecombinantVEGF-C,Human

Product Overview

• Article Name: RecombinantVEGF-C,Human
• Biozol Catalog Number: BWT-BK0336
• Supplier Catalog Number: BK0336
• Alternative Catalog Number: BWT-BK0336-10UG,BWT-BK0336-1MG,BWT-BK0336-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Vascular endothelial growth factor C (VEGF-C) is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family, is active in angiogenesis, lymphangiogenesis and endothelial cell growth and survival, and can also aff

Product Properties

• Molecular Weight: 16~19 kDa, observed by reducing SDS-PAGE.
• Source: HEK 293
• Purity: > 95% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: MAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITV PLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.