Recombinant Human BCA-1 (rHuBCA-1/CXCL13)

Catalog Number: BWT-PR1004
Article Name: Recombinant Human BCA-1 (rHuBCA-1/CXCL13)
Biozol Catalog Number: BWT-PR1004
Supplier Catalog Number: PR1004
Alternative Catalog Number: BWT-PR1004-5UG,BWT-PR1004-20UG,BWT-PR1004-1.0MG
Manufacturer: Bioworld Technology
Category: Biochemikalien
CXCL13, also known as B-lymphocyte chemoattractant (BLC), is a CXC chemokine that is constitutively expressed in secondary lymphoid organs. BCA-1 cDNA encodes a protein of 109 amino acid residues with a leader sequence of 22 residues. Mature human BCA-1
Molecular Weight: 10.3 kDa, a single non-glycosylated polypeptide chain containing 87 amino acids.
Source: Escherichia coli.
Purity: >97% by SDS-PAGE and HPLC analyses.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
Formula: Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio