Recombinant Human Eotaxin-2 (rHuEotaxin-2/CCL24)

Catalog Number: BWT-PR1017
Article Name: Recombinant Human Eotaxin-2 (rHuEotaxin-2/CCL24)
Biozol Catalog Number: BWT-PR1017
Supplier Catalog Number: PR1017
Alternative Catalog Number: BWT-PR1017-5UG,BWT-PR1017-20UG,BWT-PR1017-1.0MG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Eotaxin, also named MPIF-2 and Ckbeta6, is a novel CC chemokine recently identified. It is produced by activated monocytes and T lymphocytes. Eotaxin-2 selectively chemoattracts cells expressing CCR3 including eosinophils, basophils, Th2 T cells, mast cells
Molecular Weight: 8.8 kDa, a single non-glycosylated polypeptide chain containing 78 amino acids.
Source: Escherichia coli.
Purity: >97% by SDS-PAGE and HPLC analyses.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVA
Formula: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio