Recombinant Human Glia Maturation Factor beta (rHuGMF-beta)

Product Overview

• Article Name: Recombinant Human Glia Maturation Factor beta (rHuGMF-beta)
• Biozol Catalog Number: BWT-PR1033
• Supplier Catalog Number: PR1033
• Alternative Catalog Number: BWT-PR1033-2UG,BWT-PR1033-10UG,BWT-PR1033-1.0MG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

GMF-beta, a brain-specific protein that belongs to the actin-binding proteins (ADF) structural family. GMF-beta appears to play a role in the differentiation, maintenance, and regeneration of the nervous system. It also supports the progression of certain auto

Product Properties

• Molecular Weight: Approximately 16.5 KDa, a single non-glycosylated polypeptide chain containing 141 amino acids.
• Source: Escherichia coli.
• Purity: >98% by SDS-PAGE and HPLC analyses.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNT EDLTEEWLREKLGFFH
• Formula: Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl.

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio