Recombinant Human GRO-alpha/MGSA (rHuGRO-alpha/MGSA(CXCL1) )

Product Overview

• Article Name: Recombinant Human GRO-alpha/MGSA (rHuGRO-alpha/MGSA(CXCL1) )
• Biozol Catalog Number: BWT-PR1036
• Supplier Catalog Number: PR1036
• Alternative Catalog Number: BWT-PR1036-5UG,BWT-PR1036-25UG,BWT-PR1036-1.0MG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

The three GRO cDNAs encode 107 amino acid precursor proteins from which the N-terminal 34 amino acid residues are cleaved to generate the mature GROs. There are no potential N-linked glycosylation sites in the amino acid sequences. GRO expression is indu

Product Properties

• Molecular Weight: 7.8 kDa, a single non-glycosylated polypeptide chain containing 73 amino acids.
• Source: Escherichia coli.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
• Formula: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio