Recombinant Human IP-10 (rHuIP-10/CXCL10)

Catalog Number: BWT-PR1075
Article Name: Recombinant Human IP-10 (rHuIP-10/CXCL10)
Biozol Catalog Number: BWT-PR1075
Supplier Catalog Number: PR1075
Alternative Catalog Number: BWT-PR1075-5UG,BWT-PR1075-25UG,BWT-PR1075-1.0MG
Manufacturer: Bioworld Technology
Category: Biochemikalien
IP-10 was originally identified as an IFN-gamma-inducible gene in monocytes, fibroblasts and endothelial cells. It has since been shown that IP-10 mRNA is also induced by LPS, IL-1beta, TNF-alpha, IL-12 and viruses. Additional cell types that have been shown to exp
Molecular Weight: 8.5 kDa, a single non-glycosylated polypeptide chain containing 77 amino acids.
Source: Escherichia coli.
Purity: >97% by SDS-PAGE and HPLC analyses.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKEMSKRSP
Formula: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio