Recombinant Human I-TAC (rHuI-TAC/CXCL11)

Catalog Number: BWT-PR1076
Article Name: Recombinant Human I-TAC (rHuI-TAC/CXCL11)
Biozol Catalog Number: BWT-PR1076
Supplier Catalog Number: PR1076
Alternative Catalog Number: BWT-PR1076-5UG,BWT-PR1076-20UG,BWT-PR1076-1.0MG
Manufacturer: Bioworld Technology
Category: Biochemikalien
CXCL11 cDNA encodes a 94 amino acid (aa) residue precursor protein with a 21 aa residue putative signal sequence, which is cleaved to form the mature 73 aa residue protein. CXCL11 shares 36% and 37% amino acid sequence homology with IP-10 and MIG (two ot
Molecular Weight: 8.3 kDa, a single non-glycosylated polypeptide chain containing 73 amino acids.
Source: Escherichia coli.
Purity: >97% by SDS-PAGE and HPLC analyses.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Formula: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio