Recombinant Human MCP-2 (rHu MCP-2/CCL8)

Catalog Number: BWT-PR1087
Article Name: Recombinant Human MCP-2 (rHu MCP-2/CCL8)
Biozol Catalog Number: BWT-PR1087
Supplier Catalog Number: PR1087
Alternative Catalog Number: BWT-PR1087-2UG,BWT-PR1087-10UG,BWT-PR1087-1.0MG
Manufacturer: Bioworld Technology
Category: Biochemikalien
MCP-2 and MCP-3 are two monocyte chemotactic proteins produced by human MG-63 osteosarcoma cells. Both MCP-2 and MCP-3 are members of the CC family of chemokines and share 62% and 71% amino acid sequence identity, respectively, with MCP-1.MCP-3 also shar
Molecular Weight: 8.9 kDa, a single non-glycosylated polypeptide chain containing 76 amino acids.
Source: Escherichia coli.
Purity: >96% by SDS-PAGE and HPLC analyses.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Formula: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio