Recombinant Human MIG (rHuMIG/CXCL9)

Catalog Number: BWT-PR1091
Article Name: Recombinant Human MIG (rHuMIG/CXCL9)
Biozol Catalog Number: BWT-PR1091
Supplier Catalog Number: PR1091
Alternative Catalog Number: BWT-PR1091-5UG,BWT-PR1091-20UG,BWT-PR1091-1.0MG
Manufacturer: Bioworld Technology
Category: Biochemikalien
CXCL9, a member of the alpha subfamily of chemokines that lack the ELR domain, was initially identified as a lymphokine-activated gene in mouse macrophages. The CXCL9 gene is induced in macrophages and in primary glial cells of the central nervous system spe
Molecular Weight: 11.7 kDa, a single non-glycosylated polypeptide chain containing 103 amino acids.
Source: Escherichia coli.
Purity: >97% by SDS-PAGE and HPLC analyses.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Formula: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio