Recombinant Human Migration Inhibitor Factor (rHuMIF) Preis auf Anfrage

Product Overview

• Article Name: Recombinant Human Migration Inhibitor Factor (rHuMIF) Preis auf Anfrage
• Biozol Catalog Number: BWT-PR1092
• Supplier Catalog Number: PR1092
• Alternative Catalog Number: BWT-PR1092-10UG,BWT-PR1092-50UG,BWT-PR1092-1.0MG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Human MIF consists of two alpha-helices and six beta-strands, four of which form a beta-sheet. The two remaining beta-strands interact with other MIF molecules, creating a trimer. Structure-function studies suggest MIF is bifunctional with segregated topology. The N-

Product Properties

• Molecular Weight: Approximately 13.5 kDa, a single non-glycosylated polypeptide chain containing 123 amino acids.
• Source: Escherichia coli
• Purity: >95% by SDS-PAGE and HPLC analyses.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFALEHHHHHH
• Formula: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio