Recombinant Human MIP-3 alpha (rHuMIP-3a/CCL20)

Catalog Number: BWT-PR1096
Article Name: Recombinant Human MIP-3 alpha (rHuMIP-3a/CCL20)
Biozol Catalog Number: BWT-PR1096
Supplier Catalog Number: PR1096
Alternative Catalog Number: BWT-PR1096-5UG,BWT-PR1096-20UG,BWT-PR1096-1.0MG
Manufacturer: Bioworld Technology
Category: Biochemikalien
MIP-3 alpha/CCL20, also known as LARC (Liver and Activation-regulated Chemokine) and as Exodus, is a CC chemokine that is expressed in the liver, lymph nodes, appendix, PBL and lung and can signal through the CCR6 receptor. MIP-3 alpha is chemotactic tow
Molecular Weight: 8.0 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids.
Source: Escherichia coli.
Purity: >97% by SDS-PAGE and HPLC analyses.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Formula: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio