Recombinant Human MIP-4 (rHuMIP-4/CCL18)

Catalog Number: BWT-PR1098
Article Name: Recombinant Human MIP-4 (rHuMIP-4/CCL18)
Biozol Catalog Number: BWT-PR1098
Supplier Catalog Number: PR1098
Alternative Catalog Number: BWT-PR1098-2UG,BWT-PR1098-10UG,BWT-PR1098-1.0MG
Manufacturer: Bioworld Technology
Category: Biochemikalien
CCL18, is a novel CC chemokine that is highly homologous to MIP-1alpha (61% amino acid sequence identity). CCL18 cDNA encodes an 89 aa residue precursor protein with a 20 aa putative signal peptide that is cleaved to generate a 69 aa residue mature protein w
Molecular Weight: 7.8 kDa, a single non-glycosylated polypeptide chain containing 69 amino acids.
Source: Escherichia coli
Purity: >97% by SDS-PAGE and HPLC analyses.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
Formula: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio