Recombinant Human Oncostatin-M (rHuOSM)

Catalog Number: BWT-PR1104
Article Name: Recombinant Human Oncostatin-M (rHuOSM)
Biozol Catalog Number: BWT-PR1104
Supplier Catalog Number: PR1104
Alternative Catalog Number: BWT-PR1104-2UG,BWT-PR1104-10UG,BWT-PR1104-1.0MG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Oncostatin M (OSM) is a growth and differentiation factor that participates in the regulation of neurogenesis, osteogenesis and hematopoiesis. Produced by activated T cells, monocytes and Kaposis sarcoma cells, OSH can exert both stimulatory and inhibito
Molecular Weight: Approximately 26.0 kDa, a single non-glycosylated polypeptide chain containing 227 amino acids.
Source: Escherichia coli.
Purity: >95% by SDS-PAGE and HPLC analyses.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR
Formula: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio