Recombinant Human Oncostatin-M(209a.a.) (rHuOSM 209a.a.)

Product Overview

• Article Name: Recombinant Human Oncostatin-M(209a.a.) (rHuOSM 209a.a.)
• Biozol Catalog Number: BWT-PR1105
• Supplier Catalog Number: PR1105
• Alternative Catalog Number: BWT-PR1105-2UG,BWT-PR1105-10UG,BWT-PR1105-1.0MG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Oncostatin M (OSM) is a growth and differentiation factor that participates in the regulation of neurogenesis, osteogenesis and hematopoiesis. Produced by activated T cells, monocytes and Kaposis sarcoma cells, OSH can exert both stimulatory and inhibito

Product Properties

• Molecular Weight: Approximately 23.9 kDa, a single non-glycosylated polypeptide chain containing 209 amino acids.
• Source: Escherichia coli.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRR
• Formula: Lyophilized from a 0.2µm filtered concentrated solution in PBS, pH 7.4.

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio