Recombinant Human Osteoprotegerin/Fc Chimera (rHuOPG-Fc)

Product Overview

• Article Name: Recombinant Human Osteoprotegerin/Fc Chimera (rHuOPG-Fc)
• Biozol Catalog Number: BWT-PR1106
• Supplier Catalog Number: PR1106
• Alternative Catalog Number: BWT-PR1106-10UG,BWT-PR1106-50UG,BWT-PR1106-1.0MG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Osteoprotegerin (OPG) is a member of the TNFR superfamily that can act as a decoy receptor for RANKL. Binding of soluble OPG to sRANKL inhibits osteoclastogenesis by interrupting the signaling between stromal cells and osteoclastic progenitor cells, ther

Product Properties

• Molecular Weight: Recombinant OPG/Fc contains 412 amino acid residues, including 180 residues from mature OPG (a.a 22-201) and 232 residues from the Fc protein of human IgG1, and has a calculated molecular mass of 46.5 kDa. As a result of glycosylation, the recombinant OP
• Source: Pichia. Pastoris.
• Purity: >90% by SDS-PAGE and HPLC analyses.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: OPG 22-201: ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGN SESTQKCGIDVTL Fc232: EPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE
• Formula: Lyophilized from a 0.2m filtered concentrated solution in PBS, pH 7.4.

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio