Recombinant Human Otoraplin (rHuOTOR)

Catalog Number: BWT-PR1107
Article Name: Recombinant Human Otoraplin (rHuOTOR)
Biozol Catalog Number: BWT-PR1107
Supplier Catalog Number: PR1107
Alternative Catalog Number: BWT-PR1107-5UG,BWT-PR1107-20UG,BWT-PR1107-500UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
OTOR, also called Otoraplin and MIAL, is a secreted cytokine and a member of the MIA/OTOR family. Members of this family which also includes MIA, MIA2, and TANGO share a Src homology-3 (SH3)-like domain. OTOR is predominantly expressed in the cochlea of
Molecular Weight: 12.7 kDa, a single non-glycosylated polypeptide chain containing 112 amino acids.
Source: Escherichia coli
Purity: Sterile Filtered White lyophilized (freeze-dried) powder.Data Not Available.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: MVHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMG VVGYFPRNLV KEQRVYQEAT KEVPTTDIDF FCE
Formula: Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio