Recombinant Human Pigment Epithelium-derived Factor (rHuPEDF)

Product Overview

• Article Name: Recombinant Human Pigment Epithelium-derived Factor (rHuPEDF)
• Biozol Catalog Number: BWT-PR1108
• Supplier Catalog Number: PR1108
• Alternative Catalog Number: BWT-PR1108-5UG,BWT-PR1108-20UG,BWT-PR1108-1.0MG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

PEDF is a noninhibitory serpin with neurotrophic, anti-angiogenic, and anti-tumorigenic properties. It is a 50 kDa glycoprotein produced and secreted in many tissues throughout the body. A major component of the anti-angiogenic action of PEDF is the indu

Product Properties

• Molecular Weight: Approximately 44.5 KDa, a single non-glycosylated polypeptide chain containing 400 amino acids.
• Source: Escherichia coli.
• Purity: >95% by SDS-PAGE and HPLC analyses.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: MQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSMSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSM
• Formula: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH7.4, 150mM NaCl.

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio