Recombinant Mouse Leukemia inhibitory factor(rMuLIF) Preis auf Anfrage

Product Overview

• Article Name: Recombinant Mouse Leukemia inhibitory factor(rMuLIF) Preis auf Anfrage
• Biozol Catalog Number: BWT-PR2005
• Supplier Catalog Number: PR2005
• Alternative Catalog Number: BWT-PR2005-5UG,BWT-PR2005-10UG,BWT-PR2005-1.0MG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Leukemia Inhibitory Factor (LIF) is a lymphoid factor which promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. LIF has a number of other activities including cholinergic neuron differentiation, control of s

Product Properties

• Molecular Weight: Approximately20 kDa, a single non-glycosylated polypeptide chain containing 181 amino acids.
• Source: Escherichia coli.
• Purity: >98% by SDS-PAGE and HPLC analyses.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
• Formula: Lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.4, with 0.02% TWEEN 20.

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio