Recombinant Murine Fibroblast Growth Factor-basic (rMubFGF )

Catalog Number: BWT-PR2015
Article Name: Recombinant Murine Fibroblast Growth Factor-basic (rMubFGF )
Biozol Catalog Number: BWT-PR2015
Supplier Catalog Number: PR2015
Alternative Catalog Number: BWT-PR2015-10UG,BWT-PR2015-50UG,BWT-PR2015-1.0MG
Manufacturer: Bioworld Technology
Category: Biochemikalien
FGF basic (FGF-2, HBGF-2) is one of at least 22 mitogenic proteins of the FGF family, which show 35 - 60% amino acid conservation. Unlike other FGFs, FGF acidic and basic lack signal peptides and are secreted by an alternate pathway. Storage pools within
Molecular Weight: Approximately 16.2 kDa, a single non-glycosylated polypeptide chain containing 146 amino acids.
Source: Escherichia coli.
Purity: >98% by SDS-PAGE and HPLC analyses.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: MPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Formula: Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio