Recombinant Murine Vascular Endothelial Growth Factor 165 (rMuVEGF165)

Catalog Number: BWT-PR2038
Article Name: Recombinant Murine Vascular Endothelial Growth Factor 165 (rMuVEGF165)
Biozol Catalog Number: BWT-PR2038
Supplier Catalog Number: PR2038
Alternative Catalog Number: BWT-PR2038-2UG,BWT-PR2038-10UG,BWT-PR2038-1.0MG
Manufacturer: Bioworld Technology
Category: Biochemikalien
VEGF was initially purified from media conditioned by normal bovine pituitary folliculo-stellate cells and by a variety of transformed cell lines as a mitogen specific for vascular endothelial cells. It was subsequently found to be identical to an indepe
Molecular Weight: Recombinant murine VEGF165 is a 39.0 kDa disulfide-linked homodimeric protein consisting of two 165 amino acid polypeptide chains.
Source: Escherichia coli.
Purity: >95% by SDS-PAGE and HPLC analyses
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Formula: Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio