Recombinant Rhesus macaque SAA1 (rRhSAA1)

Catalog Number: BWT-PR5003
Article Name: Recombinant Rhesus macaque SAA1 (rRhSAA1)
Biozol Catalog Number: BWT-PR5003
Supplier Catalog Number: PR5003
Alternative Catalog Number: BWT-PR5003-5UG,BWT-PR5003-20UG,BWT-PR5003-1.0MG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Serum amyloid A proteins (SAA) represents a family of apolipoproteins that circulates in association with high-density lipoproteins (HDL). The level of apo-SAA, normally 1-5 µg/ml in plasma, increases 500-1000 fold within 24 hours of an inflammatory stim
Molecular Weight: Approximately 11.8 kDa, a single non-glycosylated polypeptide chain containing 104 amino acids.
Source: Escherichia coli.
Purity: >97% by SDS-PAGE and HPLC analyses.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: RSWFSFLGEAYDGARDMWRAYSDMKEANYKNSDKYFHARGNYDAAQRGPGG VWAAEVISDARENIQKLLGRGAEDTLADQAANEWGRSGKDPNHFRPAGLPEKY
Formula: Lyophilized from a 0.2m filtered concentrated solution in PBS, pH 7.4.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio