Recombinant Cyclin-Dependent Kinase Inhibitor 2A (rHuP16-INK4a)

Catalog Number: BWT-PR6001
Article Name: Recombinant Cyclin-Dependent Kinase Inhibitor 2A (rHuP16-INK4a)
Biozol Catalog Number: BWT-PR6001
Supplier Catalog Number: PR6001
Alternative Catalog Number: BWT-PR6001-10UG,BWT-PR6001-50UG,BWT-PR6001-1.0MG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Cyclin-dependent kinase inhibitors (CDKIs) are proteins that bind to and inhibit the activity of CDKs. Two major classes of CDK inhibitors have been identified. The p16 family (p15, p16, p18 and p19) binds to and inhibits the activities of CDK4 and CDK6.
Molecular Weight: Approximately 16.5 kDa, a single non-glycosylated polypeptide chain containing 156 amino acids.
Source: Escherichia coli
Purity: >95% by SDS-PAGE and HPLC analyses.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEE LGHRDVARYL RAAAGGTRGS NHARIDAAEG PSDIPD
Formula: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio