Recombinant Human Zinc finger and SCAN domain-containing protein 1 (ZSCAN1)

Catalog Number: BYT-ORB1096086
Article Name: Recombinant Human Zinc finger and SCAN domain-containing protein 1 (ZSCAN1)
Biozol Catalog Number: BYT-ORB1096086
Supplier Catalog Number: orb1096086
Alternative Catalog Number: BYT-ORB1096086-20, BYT-ORB1096086-100, BYT-ORB1096086-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Recombinant Human Zinc finger and SCAN domain-containing protein 1(ZSCAN1)
Molecular Weight: 49.2 kDa
UniProt: Q8NBB4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MLPRPKAPASPRRPQTPTPSEQDADPGPASPRDTEAQRLRFRQFQYHVASGPHLALGQLWTLCRQWLRPEARSKEQMLELLVLEQFLGALPSKMRTWVQSQGPRSCREAASLVEDLTQMCQQEVLVSLDSVEPQDWSFGEEEDGKSPRSQKEPSQASELILDAVAAAPALPEESEWLETTQLQQSLHTRAEAEAPRAPGLLGSRARLPLKPSIWDEPEDLLAGPSSDLRAEGTVISSPKGPSAQRISPRRRNRN
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration