Recombinant Human E3 ubiquitin-protein ligase ZNRF3 (ZNRF3), partial

Product Overview

• Article Name: Recombinant Human E3 ubiquitin-protein ligase ZNRF3 (ZNRF3), partial
• Biozol Catalog Number: BYT-ORB1096087
• Supplier Catalog Number: orb1096087
• Alternative Catalog Number: BYT-ORB1096087-20, BYT-ORB1096087-100, BYT-ORB1096087-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: RING finger protein 203 Zinc/RING finger protein 3

Product Description

Recombinant Human E3 ubiquitin-protein ligase ZNRF3(ZNRF3),partial

Product Properties

• Molecular Weight: 23.8 kDa
• UniProt: Q9ULT6
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration