Recombinant Human Fructose-bisphosphate aldolase C (ALDOC)

Catalog Number: BYT-ORB1096090
Article Name: Recombinant Human Fructose-bisphosphate aldolase C (ALDOC)
Biozol Catalog Number: BYT-ORB1096090
Supplier Catalog Number: orb1096090
Alternative Catalog Number: BYT-ORB1096090-20, BYT-ORB1096090-100, BYT-ORB1096090-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Brain-type aldolase
Recombinant Human Fructose-bisphosphate aldolase C(ALDOC)
Molecular Weight: 40.5 kDa
UniProt: P09972
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYTPEEIAMATV
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration