Recombinant Murine polyomavirus Major capsid protein VP1

Catalog Number: BYT-ORB1096097
Article Name: Recombinant Murine polyomavirus Major capsid protein VP1
Biozol Catalog Number: BYT-ORB1096097
Supplier Catalog Number: orb1096097
Alternative Catalog Number: BYT-ORB1096097-20, BYT-ORB1096097-100, BYT-ORB1096097-500, BYT-ORB1096097-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Major structural protein VP1
Recombinant Murine polyomavirus Major capsid protein VP1
Molecular Weight: 42.5 kDa
UniProt: P24595
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Murine polyomavirus (strain Kilham) (MPyV) (Murine pneumotropic virus)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: APTVKKRTSQNQGLSPQKSQNSVVVGGIQVLDVRTGPDSITQIEAFLNPRMGKPVDSDFYGFSDNITVSADYTQDMPRIKELPCYSMAKISLPMLNEDMTCDTILMWEAISCKTEVVGVSSLTNCHSAVKRLYDNEGAGFPVQGLNFHFFSVGGEALDLQWLWKNYRCNYPAGVAALQAAPKAAQVLDPKLKAKLTADGKFPIEAWSPDPAKNENTRYFGTYTGGLQTPPVLQITNTTTTILLNENGVGPLCKG
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration