Recombinant Human Protein Wiz (WIZ), partial

Catalog Number: BYT-ORB1096104
Article Name: Recombinant Human Protein Wiz (WIZ), partial
Biozol Catalog Number: BYT-ORB1096104
Supplier Catalog Number: orb1096104
Alternative Catalog Number: BYT-ORB1096104-20, BYT-ORB1096104-100, BYT-ORB1096104-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Widely-interspaced zinc finger-containing protein, Zinc finger protein 803
Recombinant Human Protein Wiz(WIZ),partial
Molecular Weight: 28.1 kDa
UniProt: O95785
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFRTRCEFCGEFFENRKGLSSHARSHLRQMGVTEWSVNGSPIDTLREILKKKSKPCLIKKEPPAGDLAPALAEDGPPTVAPGPVQSPLPLSPLAGRPGKPGAGPAQVPRELSLTPITGAKPSATGYLGSVAAKRPLQEDRLLPAEVKAKTYIQTELPFKAKTLHEKTSHSSTEACCELCGLYFENRKALASHARAH
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration