Recombinant Arabidopsis thaliana Plasmodesmata-located protein 7 (PDLP7)

Product Overview

• Article Name: Recombinant Arabidopsis thaliana Plasmodesmata-located protein 7 (PDLP7)
• Biozol Catalog Number: BYT-ORB1096108
• Supplier Catalog Number: orb1096108
• Alternative Catalog Number: BYT-ORB1096108-20, BYT-ORB1096108-100, BYT-ORB1096108-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Cysteine-rich repeat secretory protein 60

Product Description

Recombinant Arabidopsis thaliana Plasmodesmata-located protein 7(PDLP7)

Product Properties

• Molecular Weight: 41.3 kDa
• UniProt: Q0WPN8
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Arabidopsis thaliana(Mouse-ear cress)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: TSATDTFVFGGCSQQKFSPASAYESNLNSLLTSLVNSATYSSYNNFTIMGSSSSDTARGLFQCRGDLSMPDCATCVARAVSQVGPLCPFTCGGALQLAGCYIKYDNISFLGQEDKTVVLKKCGSSEGYNTDGISRRDAVLTELVNGGGYFRAGGSGDVQGMGQCVGDLTVSECQDCLGTAIGRLKNDCGTAVFGDMFLAKCYARYSTDGAQHYAKSHNYKTNYGGEKTFAIIIGLLAAVVLLIIFLLFLRGVCS

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration