Recombinant Streptococcus equi subsp. zooepidemicus IgG endopeptidase (ideZ)

Product Overview

• Article Name: Recombinant Streptococcus equi subsp. zooepidemicus IgG endopeptidase (ideZ)
• Biozol Catalog Number: BYT-ORB1096109
• Supplier Catalog Number: orb1096109
• Alternative Catalog Number: BYT-ORB1096109-20, BYT-ORB1096109-100, BYT-ORB1096109-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide

Product Description

Recombinant Streptococcus equi subsp. zooepidemicus IgG endopeptidase(ideZ)

Product Properties

• Molecular Weight: 37.3 kDa
• UniProt: Q0PIW1
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Streptococcus equi subsp. zooepidemicus
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: DDYQRNAAEVYAKEVPHQITSVWTKGVTPLTPEQFRYNNEDVIHAPYLAHQGWYDITKVFDGKDNLLCGAATAGNMLHWWFDQNKTEIEAYLSKHPEKQKIIFNNQELFDLKAAIDTKDSQTNSQLFNYFRDKAFPNLSARQLGVMPDLVLDMFINGYYLNVFKTQSTDVNRPYQDKDKRGGIFDAVFTRGDQTTLLTARHDLKNKGLNDISTIIKQELTEGRALALSHTYANVSISHVINLWGADFNAEGNLE

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration